PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV23948.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 166aa    MW: 19238.1 Da    PI: 10.4274
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV23948.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.9e-18666257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                ++R+++t+eq  +L+el+ +    p+ ++++ ++++l    ++  ++V++WFqN++a++++
  KZV23948.1  6 STRWCPTPEQRMILKELYSRgLTSPNSSQIQNITAHLslygKIHGKNVFYWFQNHKARQRQ 66
                58*****************99**************************************97 PP

2Wus_type_Homeobox1092.8e-35667364
  Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       +tRW+PtpeQ +iL+ely++Gl +Pn+++iq+ita+L+ yGki++kNVfyWFQN+kaR+rqk
         KZV23948.1  6 STRWCPTPEQRMILKELYSRGLTSPNSSQIQNITAHLSLYGKIHGKNVFYWFQNHKARQRQK 67
                       79***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.2E-4471IPR001356Homeobox domain
CDDcd000860.00123767No hitNo description
SuperFamilySSF466893.59E-10767IPR009057Homeodomain-like
PfamPF000468.4E-16766IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-6866IPR009057Homeodomain-like
PROSITE profilePS500718.7621267IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MPPFSSTRWC PTPEQRMILK ELYSRGLTSP NSSQIQNITA HLSLYGKIHG KNVFYWFQNH  60
KARQRQKLRK KFAIAKQLQQ HQHYHHFHSF AGNFHPQLAF EANNGAVMKH AWCTAPQHLL  120
PRDDLMKIPT LPACCENRPL ETLQLFPLTS PGLTDHQQTT KASINF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090087.14e-46PREDICTED: WUSCHEL-related homeobox 3
TrEMBLA0A068VNJ63e-38A0A068VNJ6_COFCA; Uncharacterized protein
STRINGGSMUA_Achr4P30610_0012e-36(Musa acuminata)
STRINGGSMUA_Achr9P04090_0012e-36(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29591951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.15e-36WOX family protein